Difference between revisions of "Team:XJTLU-CHINA/PeptideProduction"
| Line 80: | Line 80: | ||
<div class="fig" align="center"> | <div class="fig" align="center"> | ||
<figure> | <figure> | ||
| − | <img width=" | + | <img width="700px" src="https://static.igem.org/mediawiki/2017/d/de/Peptide_Production_2a.png"> |
<figcaption><strong> 2a: LL-37 structure and residues（PDB 2K6O）</strong></figcaption> | <figcaption><strong> 2a: LL-37 structure and residues（PDB 2K6O）</strong></figcaption> | ||
</figure> | </figure> | ||
<figure> | <figure> | ||
| − | <img width=" | + | <img width="700px" src="https://static.igem.org/mediawiki/2017/2/29/Peptide_Production_2b.png"> |
<figcaption><strong>Figure 2b: LL-37 secondary structure prediction (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html | <figcaption><strong>Figure 2b: LL-37 secondary structure prediction (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html | ||
). | ). | ||
| Line 90: | Line 90: | ||
</figure> | </figure> | ||
<figure> | <figure> | ||
| − | <img width=" | + | <img width="700px" src="https://static.igem.org/mediawiki/2017/3/3b/Peptide_Production_2c.png"> |
<figcaption><strong> 2c: Biological functions of LL-37 (Ramos, Domingues, and Gama, 2011)</strong></figcaption> | <figcaption><strong> 2c: Biological functions of LL-37 (Ramos, Domingues, and Gama, 2011)</strong></figcaption> | ||
</figure> | </figure> | ||
Revision as of 09:03, 30 October 2017
Peptide Production
Anti-Microbial Peptide
Anti-microbial peptide (AMP) is a part of the innate immune system of most multi-cellular organisms to counter microbial infections (Margitta and Torsten, 1999). The cationic and amphipathic α-helix structure is the most wildly conformation in those peptides but some hydrophobic α-helical peptides which possess antimicrobial activity. This year we choose three different cationic antimicrobial peptides which encompass α-helical conformation in our project.
Figure 1 shows the molecular mechanism of cationic AMPs α-helical structure. Most of cationic AMPs associate with lipid group of bacteria membrane. The α-helical structure disrupt the packing of lipid molecules such that the membrane becomes leaky (Rocca et al., 1999).
LL-37
LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans (Dürr, Sudheendra and Ramamoorthy, 2006). Mature LL-37 has 37 amino acid residues starting with two leucines (NH2-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH). The peptide is cleaved from a larger protein, hCAP-18 by extracellular proteolysis of proteinase 3 from the C-terminal end of hCAP18 (Patricia, 2010; Ramos, Domingues, and Gama, 2011). The peptide composed of two mainly parts: from residue Leu2 to Leu31 is α-helical structure (Fig 2b) and 6 residues form loop structure (Fig 2a).
Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response to wound or infection sites, binding and neutralizing LPS, and wound closure apart from anti-microbial property (Figure 2c).
