Difference between revisions of "Team:XJTLU-CHINA/PeptideProduction"

Line 80: Line 80:
 
         <div class="fig" align="center">
 
         <div class="fig" align="center">
 
             <figure>
 
             <figure>
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/d/de/Peptide_Production_2a.png">
+
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/d/de/Peptide_Production_2a.png">
 
                 <figcaption><strong> 2a: LL-37 structure and residues(PDB 2K6O)</strong></figcaption>
 
                 <figcaption><strong> 2a: LL-37 structure and residues(PDB 2K6O)</strong></figcaption>
 
             </figure>
 
             </figure>
 
             <figure>
 
             <figure>
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/2/29/Peptide_Production_2b.png">
+
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/2/29/Peptide_Production_2b.png">
 
                 <figcaption><strong>Figure 2b: LL-37 secondary structure prediction (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html
 
                 <figcaption><strong>Figure 2b: LL-37 secondary structure prediction (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html
 
                     ).
 
                     ).
Line 90: Line 90:
 
             </figure>
 
             </figure>
 
             <figure>
 
             <figure>
                     <img width="650px" src="https://static.igem.org/mediawiki/2017/3/3b/Peptide_Production_2c.png">
+
                     <img width="700px" src="https://static.igem.org/mediawiki/2017/3/3b/Peptide_Production_2c.png">
 
                     <figcaption><strong> 2c: Biological functions of LL-37 (Ramos, Domingues, and Gama, 2011)</strong></figcaption>
 
                     <figcaption><strong> 2c: Biological functions of LL-37 (Ramos, Domingues, and Gama, 2011)</strong></figcaption>
 
                 </figure>
 
                 </figure>

Revision as of 09:03, 30 October 2017

Peptide Production

Peptide Production

Anti-Microbial Peptide

Anti-microbial peptide (AMP) is a part of the innate immune system of most multi-cellular organisms to counter microbial infections (Margitta and Torsten, 1999). The cationic and amphipathic α-helix structure is the most wildly conformation in those peptides but some hydrophobic α-helical peptides which possess antimicrobial activity. This year we choose three different cationic antimicrobial peptides which encompass α-helical conformation in our project.

Figure 1 shows the molecular mechanism of cationic AMPs α-helical structure. Most of cationic AMPs associate with lipid group of bacteria membrane. The α-helical structure disrupt the packing of lipid molecules such that the membrane becomes leaky (Rocca et al., 1999).

1: The interaction mechanism of cationic α-helical structure of Anti-microbial peptides. The α-helical structure insert into the bacteria Lipid bilayer in aqueous solution. Following insertion of the peptide, the bilayer membrane permeability may be varied.

LL-37

LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans (Dürr, Sudheendra and Ramamoorthy, 2006). Mature LL-37 has 37 amino acid residues starting with two leucines (NH2-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH). The peptide is cleaved from a larger protein, hCAP-18 by extracellular proteolysis of proteinase 3 from the C-terminal end of hCAP18 (Patricia, 2010; Ramos, Domingues, and Gama, 2011). The peptide composed of two mainly parts: from residue Leu2 to Leu31 is α-helical structure (Fig 2b) and 6 residues form loop structure (Fig 2a).

Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response to wound or infection sites, binding and neutralizing LPS, and wound closure apart from anti-microbial property (Figure 2c).

2a: LL-37 structure and residues(PDB 2K6O)
Figure 2b: LL-37 secondary structure prediction (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html ).
2c: Biological functions of LL-37 (Ramos, Domingues, and Gama, 2011)