Difference between revisions of "Team:XJTLU-CHINA/PeptideProduction"

 
(12 intermediate revisions by 3 users not shown)
Line 38: Line 38:
 
     <div class="container">
 
     <div class="container">
 
         <div class="para">
 
         <div class="para">
             <h1>Anti-Microbial Peptide</h1>
+
            <p style="font-size: 25px">
 +
            The peptide production contains two parts: cross-inhibition and antimicrobial peptides
 +
            </p>
 +
             <h1>Cross-inhibition</h1>
 +
 
 +
 
 +
            <p style="font-size:20px">
 +
                As introduced in the description section, there are four different classes in the Agr quorum sensing systems which are referred
 +
                to as Agr-I, Agr-II, Agr-III, and Agr-IV and each is capable of recognizing a unique AIP structure, which
 +
                is AIP-I, AIP-II, AIP-III and AIP-IV, respectively.
 +
                <i>S. aureus </i>may also be classified into four groups/strains (I to IV) according to the class of the AIPs
 +
                produced. Similarly, the proteins involved in signal biosynthesis (AgrB and AgrD) and surface receptor binding
 +
                (AgrC) also show variability. Interestingly, different AIP signals cross-inhibit the activity of the others.
 +
            </p>
 +
        </div>
 +
 
 +
 
 +
        <div class="fig" align="center">
 +
            <figure>
 +
                <img width="650px" src="https://static.igem.org/mediawiki/2017/9/93/Detection2.png">
 +
                <figcaption>
 +
                    <strong>Figure 1a The structure and cross-inhibition of AIPs</strong>
 +
                </figcaption>
 +
            </figure>
 +
        </div>
 +
 
 +
        <div class="para">
 +
            <p style="font-size:20px">For the cross-inhibition, we introduce two genes, agrB and agrD from a different type of
 +
                <i>S.aureus</i>. The transmembrane protein AgrB cleaves the precursor peptide AgrB into a different type of
 +
                AIPs which is capable of inhibiting the combination of the original AIPs with the membrane AgrC, and thus
 +
                stopping the quorum sensing and growth of biofilms. The construction is shown below.</p>
 +
        </div>
 +
 
 +
        <div class="fig" align="center">
 +
            <figure>
 +
                <img width="650px" src="https://static.igem.org/mediawiki/2017/0/09/%E5%BE%AE%E4%BF%A1%E6%88%AA%E5%9B%BE_20171116173734.jpg">
 +
                <figcaption>
 +
                    <strong>Figure 1b The construction of the cross-inhibition part</strong>
 +
                </figcaption>
 +
            </figure>
 +
        </div>
 +
 
 +
        <div class="para">
 +
            <h1>Antimicrobial Peptide</h1>
 +
<img class="img-responsive center-block" src="  https://static.igem.org/mediawiki/2017/3/3f/Circuit_Peptides.png " height=700 width=800>
 
             <p style="font-size:20px">
 
             <p style="font-size:20px">
 
                 Anti-microbial peptide (AMP) is a part of the innate immune system of most multi-cellular organisms to counter microbial
 
                 Anti-microbial peptide (AMP) is a part of the innate immune system of most multi-cellular organisms to counter microbial
                 infections (Margitta and Torsten, 1999). The cationic and amphipathic α-helical structure is the most commonly
+
                 infections (Margitta and Torsten, 1999). Among these structural groups, α-helix and β-sheet structures are
                conformation in those peptides but some hydrophobic α-helical peptides which possess antimicrobial activity.
+
                more common. AMPs kill cells by disrupting membrane integrity (via interaction with the negatively charged
                This year we choose three different cationic antimicrobial peptides which encompass α-helical conformation
+
                molecules on the cell membrane), by inhibiting proteins, DNA and RNA synthesis, or by interacting with certain
                in our project.
+
                intracellular targets. All AMPs known by the late-90s are cationic. However, the concept that AMPs need to
 +
                be cationic was changed later with the discovery of negatively charged AMPs in 1997. For example maximin-H5
 +
                from frog skin and dermicidin secreted from the sweat gland tissues of humans are both anionic peptides (Bahar,
 +
                and Ren, 2013).
 +
            </p>
 +
            <p style="font-size:20px">
 +
                One of important features of AMPs is their rapid killing effect. AMPs can influence cell membrane in few seconds after contact.
 +
                AMPs are also known to enhance the activities of antibiotics through their synergistic effects. For example,
 +
                the combination of penicillin with pediocin and ampicillin with nisin Z exhibited a killing effect on
 +
                <i>Pseudomonas fluorescens</i> with 13- and 155-fold lower in the minimum inhibitory concentration (MIC), respectively,
 +
                compared to using the antibiotics alone (Bahar, and Ren, 2013).
 +
            </p>
 +
            <p style="font-size:20px">
 +
                Another feature of AMPs is their activation on the immune response defense. As shown by Figure 1c, the role of cationic host-defense
 +
                peptides in modulating the innate immune response and boosting infection-resolving immunity while dampening
 +
                potentially harmful pro-inflammatory responses gives these peptides the potential to become an entirely new
 +
                therapeutic approach against bacterial infections(Hancock & Sahl, 2006).
 +
            </p>
 +
        </div>
 +
 
 +
        <div class="fig" align="center">
 +
            <figure>
 +
                <img width="650px" src="https://static.igem.org/mediawiki/2017/3/3d/The_general_function_of_antimicrobial_peptide.png">
 +
                <figcaption>
 +
                    <strong>Figure 1c: The general function of antimicrobial peptide. Antimicrobial peptides can active immune response
 +
                        of human and kill target directly (Hancock & Sahl, 2006).</strong>
 +
                </figcaption>
 +
            </figure>
 +
        </div>
 +
 
 +
        <div class="para">
 +
            <p style="font-size:20px">
 +
                Although bacteria have diverse mechanisms of resistance to AMPs, it is encouraging to notice that the general lipid bilayer
 +
                structure of bacterial membranes makes it hard to develop a complete resistance against AMPs. Also, the resistance
 +
                against AMPs reported to date is not as strong as those against antibiotics and it is only found in a limited
 +
                number of AMPs.
 +
            </p>
 +
 
 +
            <h1>Cationic and amphipathic antimicrobial Peptides</h1>
 +
            <p style="font-size:20px">
 +
                The cationic and amphipathic α-helical structure is the most common conformation in these types of peptides but some hydrophobic
 +
                α-helical peptides can also possess antimicrobial activity. In this project we choose three different cationic
 +
                antimicrobial peptides with α-helical conformation.
 
             </p>
 
             </p>
 
             <p style="font-size:20px">
 
             <p style="font-size:20px">
                 Figure 1 shows the molecular mechanism of cationic AMPs α-helical structure. Most of cationic AMPs associate with lipid group
+
                 Figure 1d shows the molecular mechanism of cationic AMPs containing α-helical structure. Most of the cationic AMPs associate
                of bacteria membrane. The α-helical structure disrupt the packing of lipid molecules such that the membrane
+
                with the charged lipid group of the bacteria plasma membrane. The α-helical structure disrupts the packing
                becomes leaky (Rocca et al., 1999).
+
                of lipid molecules such that the membrane becomes leaky (Rocca et al.,1999).
 
             </p>
 
             </p>
 
         </div>
 
         </div>
Line 57: Line 143:
 
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/9/99/Peptide_Production_1.png">
 
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/9/99/Peptide_Production_1.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong> 1: The interaction mechanism of cationic α-helical structure of Anti-microbial peptides. The α-helical
+
                     <strong>Figure 1d:The interaction mechanism of the cationic α-helical structure of anti-microbial peptides with
                        structure insert into the bacteria Lipid bilayer in aqueous solution. Following insertion of the
+
                        the bacterial membrane. The α-helical structure partitions between the lipid bilayer and the aqueous
                        peptide, the bilayer membrane permeability may be varied.</strong>
+
                        solution. Following insertion of the peptide, the bilayer membrane permeability may be perturbed.</strong>
 
                 </figcaption>
 
                 </figcaption>
 
             </figure>
 
             </figure>
Line 71: Line 157:
 
                 The peptide is cleaved from a larger protein, hCAP-18 by extracellular proteolysis of proteinase 3 from the
 
                 The peptide is cleaved from a larger protein, hCAP-18 by extracellular proteolysis of proteinase 3 from the
 
                 C-terminal end of hCAP18 (Patricia, 2010; Ramos, Domingues, and Gama, 2011). The peptide composed of two
 
                 C-terminal end of hCAP18 (Patricia, 2010; Ramos, Domingues, and Gama, 2011). The peptide composed of two
                 mainly parts: from residue Leu2 to Leu31 is α-helical structure (Fig 2b) and 6 residues form loop structure
+
                 mainly parts: from residue Leu2 to Leu31, which is a α-helical structure (Fig 2b) and a 6 residues form the
                 (Fig 2a).
+
                 loop structure at the terminus(Fig 2a).
 
             </p>
 
             </p>
 
             <p style="font-size:20px">
 
             <p style="font-size:20px">
 
                 Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response
 
                 Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response
                 to wound or infection sites, binding and neutralizing LPS, and wound closure apart from anti-microbial property
+
                 in wounds or infection sites, binding and neutralizing LPS, and wound closure, apart from anti-microbial
                 (Figure 2c).
+
                 property (Figure 2c).
 
             </p>
 
             </p>
 
         </div>
 
         </div>
Line 85: Line 171:
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/d/de/Peptide_Production_2a.png">
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/d/de/Peptide_Production_2a.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong> 2a: LL-37 structure and residues(PDB 2K6O)</strong>
+
                     <strong>Figure 2a: LL-37 structure and its amino acid residues(PDB 2K6O)</strong>
 
                 </figcaption>
 
                 </figcaption>
 
             </figure>
 
             </figure>
Line 91: Line 177:
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/2/29/Peptide_Production_2b.png">
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/2/29/Peptide_Production_2b.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong>Figure 2b: LL-37 secondary structure prediction (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html
+
                     <strong>Figure 2b: Prediction on the LL-37 secondary structure
                        ).
+
 
                     </strong>
 
                     </strong>
 
                 </figcaption>
 
                 </figcaption>
Line 106: Line 191:
 
         <div class="para">
 
         <div class="para">
 
             <h1>GF-17</h1>
 
             <h1>GF-17</h1>
             <p style="font-size:20px">GF-17 is a high efficiency anti-microbial peptide which modified from LL-37 residue Phe-17 to Val-32 (Fig 3a).
+
             <p style="font-size:20px">GF-17 is a highly efficient anti-microbial peptide derived from the residure Phe-17 to Val-32 of LL-37(Fig 3a).
 
             </p>
 
             </p>
 
         </div>
 
         </div>
Line 120: Line 205:
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/8/83/Peptide_Production_3b.png">
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/8/83/Peptide_Production_3b.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong>Figure3b: Cartoon view of GF-17 structure (PDB: 2L5M)</strong>
+
                     <strong>Figure3b: Cartoon view of the α-helical structure of GF-17 (PDB: 2L5M)</strong>
 
                 </figcaption>
 
                 </figcaption>
 
             </figure>
 
             </figure>
Line 126: Line 211:
  
 
         <div class="para">
 
         <div class="para">
             <p style="font-size:20px">Table shows the Minimal Inhibitory concentration (MIC) of Anti-microbial peptides GF-17, GF-18 and their variants.
+
             <p style="font-size:20px">The minimal inhibitory concentrations (MIC) of several important antimicrobial peptides GF-17, GF-18 and their
                 GF-17 was capable of eliminating both Gram-positive and Gram-negative bacteria, such as S. aureus USA300
+
                 variants were shown in Table 1. GF-17 was very efficient in eliminating both Gram-positive and Gram-negative
                 and E. coli K-12 in vitro (Wang et al., 2011). Additionally, to compare with LL-37, GF-17 has highly efficiency
+
                bacteria, such as S. aureus USA300and
                 on anti-Staphylococcus aureus biofilm and killing efficiency (Fig 3c, table) ( Mishra et al., 2016; Wang
+
                 <i> E. coli</i> K-12in vitro (Wang et al., 2011). Additionally, to compare with LL-37, GF-17 is highly efficient
                et al., 2011 ).</p>
+
                 in inhibition of biofilm formation and killing efficiency on
 +
                <i>Staphylococcus aureus</i> (Fig 3c, table) ( Mishra et al., 2016; Wang et al., 2011 ).</p>
 
         </div>
 
         </div>
  
Line 137: Line 223:
 
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/b/bc/Peptide_Production_table.png">
 
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/b/bc/Peptide_Production_table.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong>Table: Antimicrobial activity (MIC in μM) of GF-17, GE-18 and their variants (Wang et al., 2011)</figcaption>
+
                     <strong>Table 1: Antimicrobial activity (MIC in μM) of GF-17, GE-18 and their variants (Wang et al., 2011)</figcaption>
 
                 </strong>
 
                 </strong>
 
             </figure>
 
             </figure>
Line 143: Line 229:
 
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/d/d5/Peptide_Production_3c.png">
 
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/d/d5/Peptide_Production_3c.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong>Figure 3c: anti-Staphylococcus aureus Biofilm assay. Two different Staphylococcus aureus strain: USA200
+
                     <strong>Figure 3c: Anti-Staphylococcus aureus biofilm assay. Two different Staphylococcus aureus strains used:
                         and USA300. The result shows the GF-17 has more efficiency to anti-Staphylococcus aureus Biofilm.(
+
                         USA200 and USA300. The result shows that GF-17 is more efficient in inhibiting the biofilm formation
                        Mishra et al., 2016)</strong>
+
                        of Staphylococcus aureus.
 +
                    </strong>
 
                 </figcaption>
 
                 </figcaption>
 
             </figure>
 
             </figure>
Line 151: Line 238:
  
 
         <div class="para">
 
         <div class="para">
             <h1>GF-17 Reverse</h1>
+
             <h1>GF-17 Reverse and GF-17 reverse peptide dimer</h1>
             <p style="font-size:20px">GF-17 reverse sequence is reverse from GF-17, the structure of GF-17 reverse sequence dimer is semihelix.</p>
+
             <p style="font-size:20px">GF-17 reverse (VLNRLFDKIRQVIRKFG) is a peptide which has a reverse peptide sequence of GF-17, and the GF-17 reverse
 +
                peptideadopts an alpha helical structure. The structure of GF-17 reverse peptide dimer (VLNRLFDKIRQVIRKFG-VLNRLFDKIRQVIRKFG)
 +
                is also α helical (Figure 4); (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html). (Mishra et
 +
                al., 2016)).
 +
            </p>
 
         </div>
 
         </div>
  
Line 159: Line 250:
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/e/ed/Peptide_Production_4.png">
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/e/ed/Peptide_Production_4.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong> 4: protein structure of GF-17 reverse dimer sequence, it seems that the dimer is semi-α helix. We assume
+
                     <strong>Figure 4: The secondary structure of GF-17 reverse dimer sequence, it seems that the dimer is α-helix.
                         the GF-17 reverse sequence is alpha helix structure. (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html
+
                         (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html )
                        )
+
 
                     </strong>
 
                     </strong>
 
                 </figcaption>
 
                 </figcaption>
Line 169: Line 259:
 
         <div class="para">
 
         <div class="para">
 
             <h1>Grammistin-Pp1</h1>
 
             <h1>Grammistin-Pp1</h1>
             <p style="font-size:20px">Grammistin-Pp1 is an AMP found in skin secretions from the clown grouper fish and is made up of thirteen amino
+
             <p style="font-size:20px">Grammistins are a group of peptides secreted by soapfishes and characterized by its amphiphilic -helical structure.
                 acid residues. This AMP is used primarily to fend off predators. Although initially thought to have little
+
                There are four types of Grammistins: Pp1,Pp3, Gs1, and Gs2. Gs 1 and Gs 2 are from
                antimicrobial properties, studies proved that grammistin-Pp1 target cell membranes by interacting with phospholipids.
+
                <i>Grammistes sexlineatus</i> and Pp 1 and Pp 3 from
                 Grammistin-Pp1 has been shown to be lethal against many gram-negative and gram-positive bacteria including
+
                <i>Pogonoperca punctata </i> (Yokota, Nagashima, and Shiom, 2001). Grammistin-Pp1 is made up of thirteen amino
                S. aureus. A primary reason for our selection of Grammistin-Pp1 was the high concentration needed to inhibit
+
                 acid residues. Studies showed that Grammistin-Pp1 could interact with phospholipids and influence the permeability
                the growth of E. coli. (Yokota et al., 2001)</p>
+
                 of membrane. Sugiyama et al. (2006) reported that the peptide Grammistin-Pp1 is effective on both Gram negative
 +
                bacteria and Gram positive bacteria, which includes </i>Staphylococcus aureus. </i>
 +
            </p>
 
         </div>
 
         </div>
  
Line 181: Line 273:
 
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/d/d8/Peptide_Production_5.png">
 
                 <img width="650px" src="https://static.igem.org/mediawiki/2017/d/d8/Peptide_Production_5.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong>Figure 5: Grammistin-Pp1 2D structure (PubChem)</strong>
+
                     <strong>Figure 5: 2D structure of Grammistin-Pp1 (PubChem)</strong>
 
                 </figcaption>
 
                 </figcaption>
 
             </figure>
 
             </figure>
Line 187: Line 279:
  
 
         <div class="para">
 
         <div class="para">
             <h1>Experiment design</h1>
+
             <h1>Experimental design on the peptide genes</h1>
 
             <h2>
 
             <h2>
                 <strong>Three copies of tandem repeats strategy (BBa_K2309028)</strong>
+
                 <strong>Using tandem repeats strategy</strong>
 
             </h2>
 
             </h2>
             <h2>Why Three copies tandem repeats?</h2>
+
             <h2>Why using three copies in the tandem repeats?</h2>
             <p style="font-size:20px">Our design using tandem repeats strategy to express several copies of anti-microbial peptide (LL-37, GF-17, and
+
             <p style="font-size:20px">Our design (BBa_K2309028)using the tandem repeats strategy to express several copies of each anti-microbial peptide
                Grammistin-Pp1)
+
                (LL-37, GF-17, and Grammistin-Pp1). Two gene will recombinant together in tandem repeats. Replication slippage
 +
                could be formed between homology sequence between long space (50-100bp in general).
 
             </p>
 
             </p>
             <h2>Why LL-37+6x His tag?</h2>
+
            <p style="font-size:20px">In our project, we put repeat sequences together as ‘---AAA---BBB---CCC---‘ rather than ‘---ABC---ABC---ABC---‘
             <p style="font-size:20px">We add 6x His tag at the end of LL-37 and the position of LL-37 with 6x His tag is at the end of whole pathway
+
                strategy. Therefore, recombination could happened between homology sequence. The replication slippage will
                 as Figure 5 shows below. This design is used for evaluating the LL-37 is produced by whole pathway. Once
+
                not formed (Gemayel. et al, 2010).</p>
                 peptide LL-37 plus his tag was detected, we assume that peptides before LL-37 (GF-17, Grammistin-Pp1, and
+
             <h2>Why adding histidine-tag on LL-37?</h2>
                 LL-37) is produced.</p>
+
             <p style="font-size:20px">We added a 6x His tag at the end of LL-37 and cloned the three copies of the tagged LL-37 gene at the end of
 +
                 the whole construct as shown in Figure 5 below. This design is used for the detection of the expression of
 +
                 the peptides from the whole construct. It is very likely that if the peptide LL-37 plus the histidine tag
 +
                was detected by immunoblotting, that the other peptides located upstream of LL-37 (GF-17, Grammistin-Pp1,
 +
                 and LL-37) were also translated .</p>
 
         </div>
 
         </div>
  
Line 206: Line 303:
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/b/bc/Peptide_Production_6.png">
 
                 <img width="700px" src="https://static.igem.org/mediawiki/2017/b/bc/Peptide_Production_6.png">
 
                 <figcaption>
 
                 <figcaption>
                     <strong>Figure 6: tandem repeats strategy.</strong>
+
                     <strong>Figure 6: the tandem repeats strategy.</strong>
 
                 </figcaption>
 
                 </figcaption>
 
             </figure>
 
             </figure>
Line 215: Line 312:
 
                 <strong>LL-37 + 6xHis tag (BBa_K2309022)</strong>
 
                 <strong>LL-37 + 6xHis tag (BBa_K2309022)</strong>
 
             </h2>
 
             </h2>
             <p style="font-size:20px">The purpose of the LL-37 with 6x His-tag is used for purifying the anti-microbial peptide production. 6xHis tag
+
             <p style="font-size:20px">The purpose of coupling 6xHis-tag with LL-37can also be used for purifying the anti-microbial peptide produced
                is six histidine amino acids tandem together which has strong affinity with Ni-NTA purification system. After
+
                in the bacterial cells.6xHis tag is six histidine amino acids tandem arranged together which has a strong
                purification, running SDS-PAGE and using dot blot method to confirm the LL-37 were produced.</p>
+
                affinity with the nickel ion in the Ni-NTA purification system. After purification, immunodot blot method
 +
                was used to confirm that LL-37 was produced.</p>
 
         </div>
 
         </div>
 
        <div class="fig" align="center">
 
            <figure>
 
                <img width="700px" src="https://static.igem.org/mediawiki/2017/3/33/Peptide_Production_7.png">
 
                <figcaption>
 
                    <strong>Figure 7: LL-37+6x His-tag</strong>
 
                </figcaption>
 
            </figure>
 
        </div>
 
 
 
         <div class="para">
 
         <div class="para">
 
             <h1>Final construction</h1>
 
             <h1>Final construction</h1>
Line 240: Line 328:
  
 
         <div class="para">
 
         <div class="para">
             <h1>Experiment brief protocol</h1>
+
             <h1>Brief experimental protocols</h1>
 
             <ol>
 
             <ol>
                 <li>
+
                 <li>Tests on the antimicrobial activities of the chemically synthesized peptides (LL-37, GF-17, and Grammistin-Pp1)
 +
                    by:
 
                     <dl>
 
                     <dl>
                         <dt>a. Inhibition Ring</dt>
+
                         <dt>a. Inhibition ring assay</dt>
                         <dt>b. Minimal Inhibitory concentration assay</dt>
+
                         <dt>b. Minimal inhibitory concentration assay</dt>
                         <dt>c. Biofilm assay</dt>
+
                         <dt>c. Biofilm formation assay</dt>
                         <dt>d. Growth curve measurement</dt>
+
                         <dt>d. Growth curve measurement (Spectrophotometric assay)</dt>
 
                     </dl>
 
                     </dl>
 
                 </li>
 
                 </li>
                 <li>Construct bio circuit to produce peptides</li>
+
                 <li>Construct the whole circuit to produce peptides</li>
                 <li>Using dot blot and 6x His tag to purify and evaluate peptides can be produced by bio circuit.</li>
+
                 <li>Using the dot blot assay and 6x His tag to purify and evaluate on the peptides produced by the whole circuit.</li>
 
             </ol>
 
             </ol>
 
         </div>
 
         </div>
  
 
         <div class="para">
 
         <div class="para">
             <h1>Reference</h1>
+
             <h1>References</h1>
 
             <ul>
 
             <ul>
 
                 <li>Wang. G., et al. (2011) ‘Decoding the Functional Roles of Cationic Side Chains of the Major Antimicrobial
 
                 <li>Wang. G., et al. (2011) ‘Decoding the Functional Roles of Cationic Side Chains of the Major Antimicrobial
Line 289: Line 378:
 
                     (Accessed: 2017 August 24
 
                     (Accessed: 2017 August 24
 
                     <sup>th</sup>)
 
                     <sup>th</sup>)
 +
                </li>
 +
                <li>
 +
                    Yokota, H., Nagashima, Y., and Shiom, K., (2001) ‘Interaction of grammistins with lipids and their antibacterial activity’,
 +
                    <i>
 +
                        Fisheries Science</i>, 2001 (67), pp. 928-933, ScienceDirect [Online]. Available from: http://www.sciencedirect.com
 +
                    (Accessed: 2017 August 26
 +
                    <sup>th</sup>)
 +
                </li>
 +
                <li>
 +
                    Sugiyama, N. et al. (2006) ‘Biological activities of synthetic grammistins and analogous peptides’,
 +
                    <i>Fisheries Science</i>, 2006 (72), pp. 1114-1120, ScienceDirect [Online]. Available from: http://www.sciencedirect.com(Accessed:
 +
                    2017 August 26
 +
                    <sup>th</sup>)
 +
                </li>
 +
                <li>
 +
                    Bahar, A., Ren, D., (2013) ‘Antimicrobial Peptides’,
 +
                    <i>pharmaceuticals, </i> 2013 (6), pp. 1543-1575, NCBI [Online]. DOI: 10.3390/ph6121543.
 +
                </li>
 +
                <li>
 +
                    Hancock, R & Sahl, H., (2006) ‘Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies’,
 +
                    <i>Nature biotechnology, </i> 24 (12), Nature [Online]. DOI: :10.1038/nbt1267
 +
                </li>
 +
                <li>
 +
                    Gemayel, R., (2010) ‘Variable Tandem Repeats Accelerate Evolution of Coding and Regulatory Sequences’,
 +
                    <i>Annual Review of Genetics, </i> ResearchGate [Online]. DOI: 10.1146/annurev-genet-072610-155046
 
                 </li>
 
                 </li>
 
             </ul>
 
             </ul>
Line 294: Line 408:
 
     </div>
 
     </div>
  
    <!-- banner -->
+
<!-- banner -->
 
     <div class="text-center" style="background:#cfe5d9;">
 
     <div class="text-center" style="background:#cfe5d9;">
        <h1 style="font-weight:bolder;color:#006934; ">Collaborators and Supporters</h1>
+
            <h1 style="font-weight:bolder;color:#006934; ">Collaborators and Supporters</h1>
        <div class="container-fluid supporters-logos">
+
            <div class="container-fluid supporters-logos">
            <div class="row" style="padding-bottom:10px">
+
                <div class="row" style="padding-bottom:10px">
 
+
   
                <div class="col-md-4 col-sm-6">
+
                    <div class="col-md-4 col-sm-6">
                    <a href="http://www.synbio-tech.com.cn">
+
                        <a href="http://www.synbio-tech.com.cn">
                        <img class="" src="https://static.igem.org/mediawiki/2017/3/38/Synbio_tech_logo.png">
+
                            <img class="" src="https://static.igem.org/mediawiki/2017/3/38/Synbio_tech_logo.png">
                    </a>
+
                        </a>
                </div>
+
                    </div>
 
+
   
                <div class="col-md-4 col-sm-6">
+
                    <div class="col-md-4 col-sm-6">
                    <a href="http://www.wx2h.com/web/index.php">
+
                        <a href="http://www.wx2h.com/web/index.php">
                        <img src="https://static.igem.org/mediawiki/2017/f/f7/Wuxi_no2_hospital_logo.png">
+
                            <img src="https://static.igem.org/mediawiki/2017/f/f7/Wuxi_no2_hospital_logo.png">
                    </a>
+
                        </a>
                </div>
+
                    </div>
 
+
   
                <div class="col-md-4 col-sm-6">
+
                    <div class="col-md-4 col-sm-6">
                    <a href="http://www.chinapeptides.qianyan.biz">
+
                        <a href="http://www.chinapeptides.qianyan.biz">
                        <img src="https://static.igem.org/mediawiki/2017/7/7d/Qiangyao_logo.png">
+
                            <img src="https://static.igem.org/mediawiki/2017/7/7d/Qiangyao_logo.png">
                    </a>
+
                        </a>
                </div>
+
                    </div>
 
+
   
                <div class="col-md-4 col-sm-6">
+
                    <div class="col-md-4 col-sm-6">
                    <a href="https://www.neb.com">
+
                        <a href="https://www.neb.com">
                        <img class="" src="https://static.igem.org/mediawiki/2017/0/06/NEB_logo.png">
+
                            <img class="" src="https://static.igem.org/mediawiki/2017/0/06/NEB_logo.png">
                    </a>
+
                        </a>
                </div>
+
                    </div>
 
+
   
                <div class="col-md-4 col-sm-6">
+
                    <div class="col-md-4 col-sm-6">
                    <a href="https://www.snapgene.com">
+
                        <a href="https://www.snapgene.com">
                        <img src="https://static.igem.org/mediawiki/2017/c/cb/Snapgene_logo.png">
+
                            <img src="https://static.igem.org/mediawiki/2017/c/cb/Snapgene_logo.png">
                    </a>
+
                        </a>
                </div>
+
                    </div>
 
+
   
                <div class="col-md-4 col-sm-6">
+
                    <div class="col-md-4 col-sm-6">
                    <a href="http://www.genscript.com">
+
                        <a href="http://www.genscript.com">
                        <img src="https://static.igem.org/mediawiki/2017/9/9b/Genscript.png">
+
                            <img src="https://static.igem.org/mediawiki/2017/9/9b/Genscript.png">
                    </a>
+
                        </a>
 +
                    </div>
 
                 </div>
 
                 </div>
 
             </div>
 
             </div>
        </div>
+
            <!-- /.container --!>
        <!-- /.container --!>
+
        </div><!-- /.text-center --!>
    </div><!-- /.text-center --!>
+
       
   
+
        <!-- footer -->
    <!-- footer -->
+
            <footer>
        <footer>
+
                <div class="text-center">
            <div class="text-center">
+
                    <div class="container-fluid">
                <div class="container-fluid">
+
                        <div class="row">
                    <div class="row">
+
                            <div class="col-md-4 loaction">
                        <div class="col-md-4 loaction">
+
                                <h4>Location</h4>
                            <h4>Location</h4>
+
                                <p style="text-align:center;">Rm 363, Science Building
                            <p style="text-align:center;">Rm 363, Science Building
+
                                    <br> Xi'an Jiaotong-Liverpool University
                                <br> Xi'an Jiaotong-Liverpool University
+
                                    <br> 111 Ren'ai Road, Suzhou, China
                                <br> 111 Ren'ai Road, Suzhou, China
+
                                    <br> 215123
                                <br> 215123
+
                                </p>
                            </p>
+
                            </div>
                        </div>
+
                            <div class="col-md-4 social">
                        <div class="col-md-4 social">
+
                                <h4>Social</h4>
                            <h4>Social</h4>
+
                                <a href="">
                            <a href="">
+
                                    <img src="https://static.igem.org/mediawiki/2017/9/9f/XJTLU_facebook.png" alt="facebook" width=30 height=30>
                                <img src="https://static.igem.org/mediawiki/2017/9/9f/XJTLU_facebook.png" alt="facebook" width=30 height=30>
+
                                </a>
                            </a>
+
                                <a href="">
                            <a href="">
+
                                    <img src="https://static.igem.org/mediawiki/2017/7/72/XJTLU_blog.png" alt="blog" width=30 height=30>
                                <img src="https://static.igem.org/mediawiki/2017/7/72/XJTLU_blog.png" alt="blog" width=30 height=30>
+
                                </a>
                            </a>
+
                            </div>
                        </div>
+
                            <div class="col-md-4 contact">
                        <div class="col-md-4 contact">
+
                                <h4>Get in touch</h4>
                            <h4>Get in touch</h4>
+
                                <img src="https://static.igem.org/mediawiki/2017/1/19/XJTLU_email.png" alt="emali" width=30 height=30>
                            <img src="https://static.igem.org/mediawiki/2017/1/19/XJTLU_email.png" alt="emali" width=30 height=30>
+
                                <p style="text-align:center;">igem@xjtlu.edu.cn</p>
                            <p style="text-align:center;">igem@xjtlu.edu.cn</p>
+
                            </div>
 
                         </div>
 
                         </div>
 
                     </div>
 
                     </div>
 
                 </div>
 
                 </div>
            </div>
+
   
 
+
                <div class="text-center" style="background:#003b73;">
            <div class="text-center" style="background:#003b73;">
+
                    <p style="text-align:center; color:white;">XJTLU-CHINA iGEM 2017</p>
                <p style="text-align:center; color:white;">XJTLU-CHINA iGEM 2017</p>
+
                </div>
            </div>
+
            </footer>
        </footer>
+
 
</body>
 
</body>
  
 
</html>
 
</html>

Latest revision as of 04:13, 27 November 2017

Peptide Production

Peptide Production

The peptide production contains two parts: cross-inhibition and antimicrobial peptides

Cross-inhibition

As introduced in the description section, there are four different classes in the Agr quorum sensing systems which are referred to as Agr-I, Agr-II, Agr-III, and Agr-IV and each is capable of recognizing a unique AIP structure, which is AIP-I, AIP-II, AIP-III and AIP-IV, respectively. S. aureus may also be classified into four groups/strains (I to IV) according to the class of the AIPs produced. Similarly, the proteins involved in signal biosynthesis (AgrB and AgrD) and surface receptor binding (AgrC) also show variability. Interestingly, different AIP signals cross-inhibit the activity of the others.

Figure 1a The structure and cross-inhibition of AIPs

For the cross-inhibition, we introduce two genes, agrB and agrD from a different type of S.aureus. The transmembrane protein AgrB cleaves the precursor peptide AgrB into a different type of AIPs which is capable of inhibiting the combination of the original AIPs with the membrane AgrC, and thus stopping the quorum sensing and growth of biofilms. The construction is shown below.

Figure 1b The construction of the cross-inhibition part

Antimicrobial Peptide

Anti-microbial peptide (AMP) is a part of the innate immune system of most multi-cellular organisms to counter microbial infections (Margitta and Torsten, 1999). Among these structural groups, α-helix and β-sheet structures are more common. AMPs kill cells by disrupting membrane integrity (via interaction with the negatively charged molecules on the cell membrane), by inhibiting proteins, DNA and RNA synthesis, or by interacting with certain intracellular targets. All AMPs known by the late-90s are cationic. However, the concept that AMPs need to be cationic was changed later with the discovery of negatively charged AMPs in 1997. For example maximin-H5 from frog skin and dermicidin secreted from the sweat gland tissues of humans are both anionic peptides (Bahar, and Ren, 2013).

One of important features of AMPs is their rapid killing effect. AMPs can influence cell membrane in few seconds after contact. AMPs are also known to enhance the activities of antibiotics through their synergistic effects. For example, the combination of penicillin with pediocin and ampicillin with nisin Z exhibited a killing effect on Pseudomonas fluorescens with 13- and 155-fold lower in the minimum inhibitory concentration (MIC), respectively, compared to using the antibiotics alone (Bahar, and Ren, 2013).

Another feature of AMPs is their activation on the immune response defense. As shown by Figure 1c, the role of cationic host-defense peptides in modulating the innate immune response and boosting infection-resolving immunity while dampening potentially harmful pro-inflammatory responses gives these peptides the potential to become an entirely new therapeutic approach against bacterial infections(Hancock & Sahl, 2006).

Figure 1c: The general function of antimicrobial peptide. Antimicrobial peptides can active immune response of human and kill target directly (Hancock & Sahl, 2006).

Although bacteria have diverse mechanisms of resistance to AMPs, it is encouraging to notice that the general lipid bilayer structure of bacterial membranes makes it hard to develop a complete resistance against AMPs. Also, the resistance against AMPs reported to date is not as strong as those against antibiotics and it is only found in a limited number of AMPs.

Cationic and amphipathic antimicrobial Peptides

The cationic and amphipathic α-helical structure is the most common conformation in these types of peptides but some hydrophobic α-helical peptides can also possess antimicrobial activity. In this project we choose three different cationic antimicrobial peptides with α-helical conformation.

Figure 1d shows the molecular mechanism of cationic AMPs containing α-helical structure. Most of the cationic AMPs associate with the charged lipid group of the bacteria plasma membrane. The α-helical structure disrupts the packing of lipid molecules such that the membrane becomes leaky (Rocca et al.,1999).

Figure 1d:The interaction mechanism of the cationic α-helical structure of anti-microbial peptides with the bacterial membrane. The α-helical structure partitions between the lipid bilayer and the aqueous solution. Following insertion of the peptide, the bilayer membrane permeability may be perturbed.

LL-37

LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans (Dürr, Sudheendra and Ramamoorthy, 2006). Mature LL-37 has 37 amino acid residues starting with two leucines (NH2-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH). The peptide is cleaved from a larger protein, hCAP-18 by extracellular proteolysis of proteinase 3 from the C-terminal end of hCAP18 (Patricia, 2010; Ramos, Domingues, and Gama, 2011). The peptide composed of two mainly parts: from residue Leu2 to Leu31, which is a α-helical structure (Fig 2b) and a 6 residues form the loop structure at the terminus(Fig 2a).

Ramos, Domingues, and Gama (2011) also reported that LL-37 has additional roles such as regulating the inflammatory response in wounds or infection sites, binding and neutralizing LPS, and wound closure, apart from anti-microbial property (Figure 2c).

Figure 2a: LL-37 structure and its amino acid residues(PDB 2K6O)
Figure 2b: Prediction on the LL-37 secondary structure
2c: Biological functions of LL-37 (Ramos, Domingues, and Gama, 2011)

GF-17

GF-17 is a highly efficient anti-microbial peptide derived from the residure Phe-17 to Val-32 of LL-37(Fig 3a).

Figure 3a: GF-17 is modified from LL-37. Amino acid residue Gly-16 is modified.
Figure3b: Cartoon view of the α-helical structure of GF-17 (PDB: 2L5M)

The minimal inhibitory concentrations (MIC) of several important antimicrobial peptides GF-17, GF-18 and their variants were shown in Table 1. GF-17 was very efficient in eliminating both Gram-positive and Gram-negative bacteria, such as S. aureus USA300and E. coli K-12in vitro (Wang et al., 2011). Additionally, to compare with LL-37, GF-17 is highly efficient in inhibition of biofilm formation and killing efficiency on Staphylococcus aureus (Fig 3c, table) ( Mishra et al., 2016; Wang et al., 2011 ).

Table 1: Antimicrobial activity (MIC in μM) of GF-17, GE-18 and their variants (Wang et al., 2011)
Figure 3c: Anti-Staphylococcus aureus biofilm assay. Two different Staphylococcus aureus strains used: USA200 and USA300. The result shows that GF-17 is more efficient in inhibiting the biofilm formation of Staphylococcus aureus.

GF-17 Reverse and GF-17 reverse peptide dimer

GF-17 reverse (VLNRLFDKIRQVIRKFG) is a peptide which has a reverse peptide sequence of GF-17, and the GF-17 reverse peptideadopts an alpha helical structure. The structure of GF-17 reverse peptide dimer (VLNRLFDKIRQVIRKFG-VLNRLFDKIRQVIRKFG) is also α helical (Figure 4); (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html). (Mishra et al., 2016)).

Figure 4: The secondary structure of GF-17 reverse dimer sequence, it seems that the dimer is α-helix. (predicted by http://www.compbio.dundee.ac.uk/jpred/index.html )

Grammistin-Pp1

Grammistins are a group of peptides secreted by soapfishes and characterized by its amphiphilic -helical structure. There are four types of Grammistins: Pp1,Pp3, Gs1, and Gs2. Gs 1 and Gs 2 are from Grammistes sexlineatus and Pp 1 and Pp 3 from Pogonoperca punctata (Yokota, Nagashima, and Shiom, 2001). Grammistin-Pp1 is made up of thirteen amino acid residues. Studies showed that Grammistin-Pp1 could interact with phospholipids and influence the permeability of membrane. Sugiyama et al. (2006) reported that the peptide Grammistin-Pp1 is effective on both Gram negative bacteria and Gram positive bacteria, which includes Staphylococcus aureus.

Figure 5: 2D structure of Grammistin-Pp1 (PubChem)

Experimental design on the peptide genes

Using tandem repeats strategy

Why using three copies in the tandem repeats?

Our design (BBa_K2309028)using the tandem repeats strategy to express several copies of each anti-microbial peptide (LL-37, GF-17, and Grammistin-Pp1). Two gene will recombinant together in tandem repeats. Replication slippage could be formed between homology sequence between long space (50-100bp in general).

In our project, we put repeat sequences together as ‘---AAA---BBB---CCC---‘ rather than ‘---ABC---ABC---ABC---‘ strategy. Therefore, recombination could happened between homology sequence. The replication slippage will not formed (Gemayel. et al, 2010).

Why adding histidine-tag on LL-37?

We added a 6x His tag at the end of LL-37 and cloned the three copies of the tagged LL-37 gene at the end of the whole construct as shown in Figure 5 below. This design is used for the detection of the expression of the peptides from the whole construct. It is very likely that if the peptide LL-37 plus the histidine tag was detected by immunoblotting, that the other peptides located upstream of LL-37 (GF-17, Grammistin-Pp1, and LL-37) were also translated .

Figure 6: the tandem repeats strategy.

LL-37 + 6xHis tag (BBa_K2309022)

The purpose of coupling 6xHis-tag with LL-37can also be used for purifying the anti-microbial peptide produced in the bacterial cells.6xHis tag is six histidine amino acids tandem arranged together which has a strong affinity with the nickel ion in the Ni-NTA purification system. After purification, immunodot blot method was used to confirm that LL-37 was produced.

Final construction

Brief experimental protocols

  1. Tests on the antimicrobial activities of the chemically synthesized peptides (LL-37, GF-17, and Grammistin-Pp1) by:
    a. Inhibition ring assay
    b. Minimal inhibitory concentration assay
    c. Biofilm formation assay
    d. Growth curve measurement (Spectrophotometric assay)
  2. Construct the whole circuit to produce peptides
  3. Using the dot blot assay and 6x His tag to purify and evaluate on the peptides produced by the whole circuit.

References

  • Wang. G., et al. (2011) ‘Decoding the Functional Roles of Cationic Side Chains of the Major Antimicrobial Region of Human Cathelicidin LL-37’, Antimicrobial Agents and Chemotherapy, pp. 845-856, ASM [Online]. DOI: 10.1128/AAC.05637-11 (Accessed: 2017 August 28 th)
  • Samperio.P (2010) ‘The human cathelicidin hCAP18/LL-37: A multifunctional peptide involved in mycobacterial infections’, Peptides , 31 (2010), pp. 1791-1798, ScienceDirect [Online]. DOI: 10.1016/j.peptides.2010.06.016 (Accessed: 2017 August 28 th )
  • Ramos. R., Domingues. L., Gama. M., (2011) ‘LL37, a human antimicrobial peptide with immunomodulatory properties’, Science against microbial pathogens: communicating current research and technological advances, pp. 915-925, ScienceDirect [Online]. Available from: www.sciencedirect.com (Accessed: 2017 August 24 th)
  • Dathe. M., Wieprecht. T., (1999) ‘Review Structural features of helical antimicrobial peptides: their potential to modulate activity on model membranes and biological cells’, Biochimica et Biophysica Acta, 1462 (1999), pp. 71-87, ScienceDirect [Online]. Available from: www.sciencedirect.com (Accessed: 2017 August 24 th)
  • Rocca. P., et al. (1999) ‘Review Simulation studies of the interaction of antimicrobial peptides and lipid bilayers ’, Biochimica et Biophysica Acta, 1462 (1999), pp. 185-200, ScienceDirect [Online]. Available from: www.sciencedirect.com (Accessed: 2017 August 24 th)
  • Dürr. U., Sudheendra. U., Ramamoorthy. A., (2006) ‘Review LL-37, the only human member of the cathelicidin family of antimicrobial peptides’, Biochimica et Biophysica Acta, 1758 (2006), pp. 1408–1425, ScienceDirect [Online]. DOI: 10.1016/j.bbamem.2006.03.030 (Accessed: 2017 August 24 th)
  • Yokota, H., Nagashima, Y., and Shiom, K., (2001) ‘Interaction of grammistins with lipids and their antibacterial activity’, Fisheries Science, 2001 (67), pp. 928-933, ScienceDirect [Online]. Available from: http://www.sciencedirect.com (Accessed: 2017 August 26 th)
  • Sugiyama, N. et al. (2006) ‘Biological activities of synthetic grammistins and analogous peptides’, Fisheries Science, 2006 (72), pp. 1114-1120, ScienceDirect [Online]. Available from: http://www.sciencedirect.com(Accessed: 2017 August 26 th)
  • Bahar, A., Ren, D., (2013) ‘Antimicrobial Peptides’, pharmaceuticals, 2013 (6), pp. 1543-1575, NCBI [Online]. DOI: 10.3390/ph6121543.
  • Hancock, R & Sahl, H., (2006) ‘Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies’, Nature biotechnology, 24 (12), Nature [Online]. DOI: :10.1038/nbt1267
  • Gemayel, R., (2010) ‘Variable Tandem Repeats Accelerate Evolution of Coding and Regulatory Sequences’, Annual Review of Genetics, ResearchGate [Online]. DOI: 10.1146/annurev-genet-072610-155046

Collaborators and Supporters

Location

Rm 363, Science Building
Xi'an Jiaotong-Liverpool University
111 Ren'ai Road, Suzhou, China
215123

Get in touch

emali

igem@xjtlu.edu.cn

XJTLU-CHINA iGEM 2017